PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_44780_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 112aa    MW: 13317.1 Da    PI: 10.271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_44780_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181762147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         rg W + Ed++l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
  cra_locus_44780_iso_1_len_335_ver_3 17 RGHWRPAEDDKLRELVAKYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 62
                                         899*****************************.***********996 PP

2Myb_DNA-binding54.23.4e-1769111145
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                          r ++++eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+
  cra_locus_44780_iso_1_len_335_ver_3  69 RSPFSEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWH 111
                                          789*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3191263IPR017930Myb domain
SMARTSM007172.4E-151665IPR001005SANT/Myb domain
SuperFamilySSF466893.15E-3017110IPR009057Homeodomain-like
PfamPF002491.7E-181762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-281870IPR009057Homeodomain-like
CDDcd001671.81E-122061No hitNo description
PROSITE profilePS5129424.96864112IPR017930Myb domain
SMARTSM007174.5E-968112IPR001005SANT/Myb domain
PfamPF002493.5E-1469111IPR001005SANT/Myb domain
CDDcd001675.65E-1071111No hitNo description
Gene3DG3DSA:1.10.10.606.0E-2071111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
AENEEKRREI IIIMCSRGHW RPAEDDKLRE LVAKYGPHNW NAIAEKLQGR SGKSCRLRWF  60
NQLDPRINRS PFSEEEEERL LASHRIHGNR WAIIARLFPG RTDNAVKNHW HV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-33171117101B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441364.15e-67hypothetical protein CICLE_v10021859mg
RefseqXP_006478100.15e-67PREDICTED: transcription factor MYB82
RefseqXP_015883899.14e-67PREDICTED: myb-related protein B-like
SwissprotQ9FDW11e-37MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A067DID95e-67A0A067DID9_CITSI; Uncharacterized protein
TrEMBLV4VNT65e-67V4VNT6_9R
STRINGPOPTR_0012s03650.12e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466